PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G16350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 360aa    MW: 39006.9 Da    PI: 6.7769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G16350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  LPERR03G16350.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding47.25e-1567142147
                      TSSS-HHHHHHHHHHHHHTTTT..............................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................tWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++l+++++ +lG++                              +W+ Ia+ ++ gRt++++k++w++y
  LPERR03G16350.1  67 RGTFSQEEEDLIIQLHSMLGNKyiliylslatcknqfimeysltinrgtnlcRWSQIAAQLP-GRTDNEVKNFWNSY 142
                      899***********************************************************.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.33965IPR017930Myb domain
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
SuperFamilySSF466892.38E-221692IPR009057Homeodomain-like
CDDcd001675.16E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-226587IPR009057Homeodomain-like
SMARTSM007173.5E-1266145IPR001005SANT/Myb domain
PROSITE profilePS5129410.80466147IPR017930Myb domain
PfamPF002496.8E-1367142IPR001005SANT/Myb domain
SuperFamilySSF466894.52E-967144IPR009057Homeodomain-like
CDDcd001676.65E-869143No hitNo description
Gene3DG3DSA:1.10.10.601.7E-22119147IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKYI LIYLSLATCK NQFIMEYSLT INRGTNLCRW  120
SQIAAQLPGR TDNEVKNFWN SYIKKKLRDR GIDPATHKPL ATDTNSNNST SRGGARAAVF  180
SDAELIPPPQ PLVDTMQQQQ LVAAADGLKT MPLDYWPSAA AGNGAAYHHH ALAAAFDMDA  240
LSQHCGGVQA ASSSSTLTSI TGLSPAAAAA ADADAGSLQP WLDLGHGSGN SGVVGTMDHY  300
AGVLDELRWS DYFDGAFQAA AATTVTQGGG QCLYDGGAGK DVVVDDDVQF VDVHSLSNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24121475108B-MYB
1h8a_C6e-241114724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3550245e-82AK355024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1014N14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629523.11e-131PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0D9VUG40.0A0A0D9VUG4_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g25550.11e-140(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.14e-71myb domain protein 50